Structure of PDB 5li0 Chain 0

Receptor sequence
>5li00 (length=46) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
RKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALK
3D structure
PDB5li0 Structure of the 70S ribosome from human pathogen Staphylococcus aureus.
Chain0
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 0 K11 S13 R17 H20 N23 S24 T25 R27 R28 N32 Q34 R52 K55 K2 S4 R8 H11 N14 S15 T16 R18 R19 N23 Q25 R43 K46
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5li0, PDBe:5li0, PDBj:5li0
PDBsum5li0
PubMed27906650
UniProtQ2FZ60|RL28_STAA8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]