Structure of PDB 3j92 Chain 0

Receptor sequence
>3j920 (length=36) Species: 9606 (Homo sapiens) [Search protein sequence]
PKKACRTCKKKFHSACLYKWFTSSNKSTCPLCRETF
3D structure
PDB3j92 Structure and Assembly Pathway of the Ribosome Quality Control Complex.
Chain0
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 0 K1748 S1752 K19 S23
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0043023 ribosomal large subunit binding
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0016567 protein ubiquitination
GO:0051865 protein autoubiquitination
GO:0072344 rescue of stalled ribosome
GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0022626 cytosolic ribosome
GO:1990112 RQC complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j92, PDBe:3j92, PDBj:3j92
PDBsum3j92
PubMed25578875
UniProtO94822|LTN1_HUMAN E3 ubiquitin-protein ligase listerin (Gene Name=LTN1)

[Back to BioLiP]