Structure of PDB 6jlu Chain 17 Binding Site BS12

Receptor Information
>6jlu Chain 17 (length=172) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENELGAQPPLGFFDPLGLVEDGNQAKFDRLRYVELKHGRISMLAVVGYLI
EKAGIRLPGNISYDGTTFADIPDGFAALSKIPDAGLFQLFAFIGFLEVFV
MKDITGGEFVGDFRNGFIDFGWDSFDEETKLKKRAIELNQGRAAMMGILA
LMVHEKLIPLGYDADLPIIGHL
Ligand information
Ligand IDKC2
InChIInChI=1S/C35H30N4O5.Mg/c1-8-19-15(3)22-12-24-17(5)21(10-11-28(40)41)32(38-24)30-31(35(43)44-7)34(42)29-18(6)25(39-33(29)30)14-27-20(9-2)16(4)23(37-27)13-26(19)36-22;/h8-14,31H,1-2H2,3-7H3,(H3,36,37,38,39,40,41,42);/q;+2/p-2/b11-10+,22-12-,23-13-,24-12-,25-14-,26-13-,27-14-,32-30-;/t31-;/m1./s1
InChIKeyQDRBYWCRXZZVLY-QIEHNWLWSA-L
SMILES
SoftwareSMILES
OpenEye OEToolkits 2.0.6Cc1c2cc3nc(c4c5c(c(c6n5[Mg]n2c(c1C=C)cc7nc(c6)C(=C7C)C=C)C)C(=O)C4C(=O)OC)C(=C3C)C=CC(=O)O
CACTVS 3.385COC(=O)[C@H]1C(=O)c2c(C)c3/C=C/4N=C(/C=C5\[N@]\6[Mg]n3c2/C1=C/7N=C(\C=C\6C(=C5C=C)C)C(=C/7/C=C/C(O)=O)C)C(=C/4C=C)C
OpenEye OEToolkits 2.0.6Cc1/c/2c/c3n/c(c/4\c5c(c(c/6n5[Mg]n2/c(/c1C=C)c\c7n/c(c6)/C(=C7C)C=C)C)C(=O)[C@@H]4C(=O)OC)/C(=C3C)/C=C/C(=O)O
CACTVS 3.385COC(=O)[CH]1C(=O)c2c(C)c3C=C4N=C(C=C5[N]6[Mg]n3c2C1=C7N=C(C=C6C(=C5C=C)C)C(=C7C=CC(O)=O)C)C(=C4C=C)C
ACDLabs 12.01N16C=3C(=C(C1=CC=7C(=C(C(=Cc2n(c5c(c2C)C(C(C(=O)OC)C5=C4C(=C(C(C=3)=N4)C)\C=C\C(=O)O)=O)[Mg]6)N=7)\C=C)C)\C=C)C
FormulaC35 H28 Mg N4 O5
NameChlorophyll c2
ChEMBL
DrugBank
ZINC
PDB chain6jlu Chain 17 Residue 311 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jlu The pigment-protein network of a diatom photosystem II-light-harvesting antenna supercomplex.
Resolution3.02 Å
Binding residue
(original residue number in PDB)		S95 Y96 P115 A117 G118 Q121 L122 F125
Binding residue
(residue number reindexed from 1)		S62 Y63 P82 A84 G85 Q88 L89 F92
Annotation score1
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 17:40:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6jlu', asym_id = '17', bs = 'BS12', title = 'The pigment-protein network of a diatom photosystem II-light-harvesting antenna supercomplex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6jlu', asym_id='17', bs='BS12', title='The pigment-protein network of a diatom photosystem II-light-harvesting antenna supercomplex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0009765,0016020', uniprot = '', pdbid = '6jlu', asym_id = '17'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009765,0016020', uniprot='', pdbid='6jlu', asym_id='17')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>