Structure of PDB 1a8a Chain A Binding Site BS11

Receptor Information

>1a8a Chain A (length=318) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALRGTVTDFSGFDGRADAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQI
AEEFKTLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGA
GTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRML
VVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSV
SHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAE
TLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGD
TSGDYKKALLLLCGGEDD

Ligand information

Ligand ID

GSE

InChI

InChI=1S/C6H14NO8P/c7-5(6(10)11)3-15-16(12,13)14-2-4(9)1-8/h4-5,8-9H,1-3,7H2,(H,10,11)(H,12,13)/t4-,5+/m1/s1

InChIKey

ZWZWYGMENQVNFU-UHNVWZDZSA-N

SMILES

Software	SMILES
ACDLabs 10.04	O=C(O)C(N)COP(=O)(OCC(O)CO)O
OpenEye OEToolkits 1.5.0	C(C(COP(=O)(O)OCC(C(=O)O)N)O)O
CACTVS 3.341	N[CH](CO[P](O)(=O)OC[CH](O)CO)C(O)=O
CACTVS 3.341	N[C@@H](CO[P@](O)(=O)OC[C@H](O)CO)C(O)=O
OpenEye OEToolkits 1.5.0	C([C@H](CO[P@](=O)(O)OC[C@@H](C(=O)O)N)O)O

Formula

C6 H14 N O8 P

Name

L-ALPHA-GLYCEROPHOSPHORYLSERINE

PDB chain

1a8a Chain A Residue 997 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1a8a Ca(2+)-bridging mechanism and phospholipid head group recognition in the membrane-binding protein annexin V.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	W185 G186 T187 E226
Binding residue (residue number reindexed from 1)	W184 G185 T186 E225
Annotation score	1

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001786	phosphatidylserine binding
GO:0005388	P-type calcium transporter activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005543	phospholipid binding
GO:0005544	calcium-dependent phospholipid binding
GO:0017046	peptide hormone binding
GO:0030971	receptor tyrosine kinase binding
GO:0042802	identical protein binding

	Biological Process
GO:0007596	blood coagulation
GO:0030195	negative regulation of blood coagulation
GO:0043065	positive regulation of apoptotic process
GO:0050819	negative regulation of coagulation
GO:0051592	response to calcium ion
GO:0070588	calcium ion transmembrane transport
GO:0071284	cellular response to lead ion
GO:0097066	response to thyroid hormone
GO:0097211	cellular response to gonadotropin-releasing hormone
GO:1901317	regulation of flagellated sperm motility
GO:1902721	negative regulation of prolactin secretion

	Cellular Component
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0008021	synaptic vesicle
GO:0009897	external side of plasma membrane
GO:0012506	vesicle membrane
GO:0014704	intercalated disc
GO:0030018	Z disc
GO:0030425	dendrite
GO:0030672	synaptic vesicle membrane
GO:0042383	sarcolemma
GO:0042995	cell projection
GO:0043025	neuronal cell body
GO:0043204	perikaryon
GO:0043679	axon terminus
GO:0072563	endothelial microparticle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1a8a, PDBe:1a8a, PDBj:1a8a
PDBsum	1a8a
PubMed	7583670
UniProt	P14668\|ANXA5_RAT Annexin A5 (Gene Name=Anxa5)

[Back to BioLiP]