Structure of PDB 6j3z Chain 15 Binding Site BS09

Receptor Information

>6j3z Chain 15 (length=176)

SEIELGVTEPLGVYDPLGWLESEPEAFERRRAVERKHGRVAMAAVVGTIV
HNNHIVFDGYLSPSNNLKFSDIPTGVDGIRAIPTAGLAQILAFFALVELA
WMPASKYDGDYGVGYFGTDIKDPEEKARKLNVELNNGRAAMMGIMGNMVA
EVLTGQTMYEQYASGHISPFGDGQGV

Ligand information

• Ligand ID: A86
• InChI: InChI=1S/C42H58O6/c1-29(18-14-19-31(3)22-23-37-38(6,7)26-35(47-33(5)43)27-40(37,10)46)16-12-13-17-30(2)20-15-21-32(4)36(45)28-42-39(8,9)24-34(44)25-41(42,11)48-42/h12-22,34-35,44,46H,24-28H2,1-11H3/b13-12+,18-14+,20-15+,29-16+,30-17+,31-19+,32-21+/t23-,34-,35-,40+,41+,42-/m0/s1
• InChIKey: SJWWTRQNNRNTPU-XJUZQKKNSA-N
• SMILES:
  OpenEye OEToolkits 2.0.6: CC(=CC=CC=C(C)C=CC=C(C)C(=O)CC12C(CC(CC1(O2)C)O)(C)C)C=CC=C(C)C=C=C3C(CC(CC3(C)O)OC(=O)C)(C)C
  ACDLabs 12.01: C\C(=C/C=C/C=C(/C=C/C=C(\C)C(=O)CC12C(C)(CC(O)CC1(C)O2)C)C)[C@H]=C[C@H]=C([C@H]=C=C3\C(C)(C)CC(CC3(O)C)OC(=O)C)C
  OpenEye OEToolkits 2.0.6: C/C(=C\C=C\C=C(/C)\C=C\C=C(/C)\C(=O)C[C@]12[C@](O1)(C[C@H](CC2(C)C)O)C)/C=C/C=C(\C)/C=C=C3[C@](C[C@H](CC3(C)C)OC(=O)C)(C)O
  CACTVS 3.385: CC(=O)O[CH]1CC(C)(C)[C](=[C]=[CH]C(C)=CC=CC(C)=CC=CC=C(C)C=CC=C(C)C(=O)C[C]23O[C]2(C)C[CH](O)CC3(C)C)[C](C)(O)C1
  CACTVS 3.385: CC(=O)O[C@H]1CC(C)(C)[C](=[C@@]=[CH]C(\C)=C\C=C\C(C)=C\C=C\C=C(C)\C=C\C=C(/C)C(=O)C[C@@]23O[C@]2(C)C[C@@H](O)CC3(C)C)[C@](C)(O)C1
• Formula: C42 H58 O6
• Name: (3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate;
  Fucoxanthin
• DrugBank: DB15462
• PDB chain: 6j3z Chain 15 Residue 310

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6j3z Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): M72 V75 F146 A169 A170 G173 G176 N177 M188
• Binding residue (residue number reindexed from 1): M42 V45 F116 A139 A140 G143 G146 N147 M158
• Annotation score: 1

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 22:22:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6j3z', asym_id = '15', bs = 'BS09', title = 'Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6j3z', asym_id='15', bs='BS09', title='Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0009765,0016020', uniprot = '', pdbid = '6j3z', asym_id = '15'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009765,0016020', uniprot='', pdbid='6j3z', asym_id='15')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>