Structure of PDB 6l4u Chain 13 Binding Site BS07

Receptor Information
>6l4u Chain 13 (length=150) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISKEAILSSPDTTEIGRVWDPLGLAEIGSAETLAWYRHSEVKHGRIAMAA
FVGWWAVGGLEAWDAVPGWGKAQMLLFAGLIEFHDELFHTRRTEGGHYLR
GGTPGKNMVPGLFDELAKGRDREIKNGRLAMIGVAGLYCAATIPGSVPLQ
Ligand information
Ligand IDKC1
InChIInChI=1S/C35H32N4O5.Mg/c1-8-19-15(3)22-12-24-17(5)21(10-11-28(40)41)32(38-24)30-31(35(43)44-7)34(42)29-18(6)25(39-33(29)30)14-27-20(9-2)16(4)23(37-27)13-26(19)36-22;/h8,10-14,31H,1,9H2,2-7H3,(H3,36,37,38,39,40,41,42);/q;+2/p-2/b11-10+,22-12-,23-13-,24-12-,25-14-,26-13-,27-14-,32-30-;/t31-;/m1./s1
InChIKeyDGNIJJSSARBJSH-QIEHNWLWSA-L
SMILES
SoftwareSMILES
ACDLabs 12.01N16C=3C(=C(C1=CC=7C(=C(C(=Cc2n(c5c(c2C)C(C(C(=O)OC)C5=C4C(=C(C(C=3)=N4)C)\C=C\C(=O)O)=O)[Mg]6)N=7)CC)C)\C=C)C
CACTVS 3.385CCC\1=C(C)C/2=NC\1=C\c3n4[Mg][N@]/5\C(=C/C6=NC(=C\7[C@@H](C(=O)OC)C(=O)c(c3C)c4\7)/C(=C6C)/C=C/C(O)=O)C(=C(C=C)C/5=C/2)C
OpenEye OEToolkits 2.0.6CCC\1=C(c2/cc\3/c(c(c4/n3[Mg]n5c(/cc1\n2)c(c6c5/c(c/7\nc(\c4)C(=C7/C=C/C(=O)O)C)/[C@H](C6=O)C(=O)OC)C)C)C=C)C
CACTVS 3.385CCC1=C(C)C2=NC1=Cc3n4[Mg][N]5C(=CC6=NC(=C7[CH](C(=O)OC)C(=O)c(c3C)c47)C(=C6C)C=CC(O)=O)C(=C(C=C)C5=C2)C
OpenEye OEToolkits 2.0.6CCC1=C(c2cc3c(c(c4n3[Mg]n5c(cc1n2)c(c6c5c(c7nc(c4)C(=C7C=CC(=O)O)C)C(C6=O)C(=O)OC)C)C)C=C)C
FormulaC35 H30 Mg N4 O5
NameChlorophyll c1
ChEMBL
DrugBank
ZINC
PDB chain6l4u Chain 13 Residue 305 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l4u Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom
Resolution2.4 Å
Binding residue
(original residue number in PDB)
W94 S98 K101 H102 I105 L155 G159 E162 E166
Binding residue
(residue number reindexed from 1)
W35 S39 K42 H43 I46 L75 G79 E82 E86
Annotation score1
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Nov 28 21:39:01 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6l4u', asym_id = '13', bs = 'BS07', title = 'Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6l4u', asym_id='13', bs='BS07', title='Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0009765,0016020', uniprot = '', pdbid = '6l4u', asym_id = '13'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009765,0016020', uniprot='', pdbid='6l4u', asym_id='13')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>