Structure of PDB 6zj3 Chain LQ Binding Site BS06

Receptor Information
>6zj3 Chain LQ (length=392) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHRKFERPRHGNMGFLPRKRCRRERGRIKTFPKDDPSQAPHLTAFLCYKA
GMTHVVRELDRPGSKMHKKEVVEAVSVMEAPPMIVVGLVGYAKTPRGLRC
LKTVWAQHLPEQFKRCFYKNWSRSKKKAFSHYSANLMGPEGKKAYEAGIA
KIKKFACVVRLIAIGQVKLLRIGQKKAHCMEIQINGGSIADKVEFGLKLF
ESSIPVDSVFKESEVVDCIGVTRGHGFEGVIHRWGVTRLPRKTHKGLRKV
ACIGAWHPARVGYTVPRAGQNGFHHRVEANKKIYKIGKSALVDKANARCE
TDLTDKTITPLGGFVRYGIVREDYLLIKGSVPGPIKRVMTIRKALRIKTN
KAFTEEVQVKFIDTSSKFGHGKFQTREEKRKFMGPTKKSALR
Ligand information
>6zj3 Chain LM (length=54) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caacaccccgcccagaccaggcuggaucugcggcgaguguaagugcagag
guua
.........<<<.......>>>............................
....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		R21 E25 R116 Y119 K120 S123 R124 S125 K126 Q175 K176 K177 R224 G225 G227 F228 F274 L312 K337 R338 S367 F369 H371 R377 K380 K389
Binding residue
(residue number reindexed from 1)		R20 E24 R115 Y118 K119 S122 R123 S124 K125 Q174 K175 K176 R223 G224 G226 F227 F273 L311 K336 R337 S366 F368 H370 R376 K379 K388
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Apr 6 22:48:21 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'LQ', bs = 'BS06', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='LQ', bs='BS06', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'LQ'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='LQ')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>