Structure of PDB 4r79 Chain B Binding Site BS06

Receptor Information

>4r79 Chain B (length=336) Species: 7226 (Drosophila mauritiana)

VPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFK
SGDFDVDDKEHGKPPKRYEDAELQALLDEDDAQTQKQLAEQLEVSQQAVS
NRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVT
GDEKWIFFVNPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIY
YELLKPGETVNAARYQQQLINLNRALQRKRPEYRVIFLHDNAPSHTARAV
RDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKW
LDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE

Ligand information

>4r79 Chain H (length=27)

aaccgacattccctacttgtacacctg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4r79 Structural Basis for the Inverted Repeat Preferences of mariner Transposases.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): E157 D249 N250 Y276
• Binding residue (residue number reindexed from 1): E153 D240 N241 Y267

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0000014 single-stranded DNA endodeoxyribonuclease activity
• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0003690 double-stranded DNA binding
• GO:0003697 single-stranded DNA binding
• GO:0004519 endonuclease activity
• GO:0042800 histone H3K4 methyltransferase activity
• GO:0044547 DNA topoisomerase binding
• GO:0046872 metal ion binding
• GO:0046975 histone H3K36 methyltransferase activity

Biological Process

• GO:0000729 DNA double-strand break processing
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0006310 DNA recombination
• GO:0006338 chromatin remodeling
• GO:0015074 DNA integration
• GO:0031297 replication fork processing
• GO:0044774 mitotic DNA integrity checkpoint signaling

Cellular Component

• GO:0000793 condensed chromosome
• GO:0005634 nucleus
• GO:0035861 site of double-strand break

External links

• PDB: RCSB:4r79, PDBe:4r79, PDBj:4r79
• PDBsum: 4r79
• PubMed: 25869132
• UniProt: Q7JQ07|MOS1T_DROMA Mariner Mos1 transposase (Gene Name=mariner\T)