Structure of PDB 3dzy Chain A Binding Site BS06

Receptor Information
>3dzy Chain A (length=302) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDK
RQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMP
VERILEAELAPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRA
GWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTEL
VSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAY
CKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLME
ML
Ligand information
Ligand IDZN
InChIInChI=1S/Zn/q+2
InChIKeyPTFCDOFLOPIGGS-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Zn++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Zn+2]
FormulaZn
NameZINC ION
ChEMBLCHEMBL1236970
DrugBankDB14532
ZINC
PDB chain3dzy Chain A Residue 7222 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dzy Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		C171 C177 C187 C190
Binding residue
(residue number reindexed from 1)		C40 C46 C56 C59
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001221 transcription coregulator binding
GO:0001972 retinoic acid binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003707 nuclear steroid receptor activity
GO:0004879 nuclear receptor activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0019899 enzyme binding
GO:0042277 peptide binding
GO:0042802 identical protein binding
GO:0042809 nuclear vitamin D receptor binding
GO:0043565 sequence-specific DNA binding
GO:0044323 retinoic acid-responsive element binding
GO:0046872 metal ion binding
GO:0050692 DNA binding domain binding
GO:0050693 LBD domain binding
GO:0070644 vitamin D response element binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0002157 positive regulation of thyroid hormone receptor signaling pathway
GO:0006355 regulation of DNA-templated transcription
GO:0009755 hormone-mediated signaling pathway
GO:0010875 positive regulation of cholesterol efflux
GO:0030154 cell differentiation
GO:0030501 positive regulation of bone mineralization
GO:0032411 positive regulation of transporter activity
GO:0032526 response to retinoic acid
GO:0035357 peroxisome proliferator activated receptor signaling pathway
GO:0042789 mRNA transcription by RNA polymerase II
GO:0043401 steroid hormone receptor signaling pathway
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048384 retinoic acid receptor signaling pathway
GO:0070564 positive regulation of vitamin D receptor signaling pathway
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0043235 receptor complex
GO:0090575 RNA polymerase II transcription regulator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3dzy, PDBe:3dzy, PDBj:3dzy
PDBsum3dzy
PubMed19043829
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]