Structure of PDB 1c7y Chain A Binding Site BS06

Receptor Information
>1c7y Chain A (length=199) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTH
FVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVN
AVEREEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVLTS
ATDDAEQEAVAALVALGYKPQEASRMVSKIARPDASSETLIREALRAAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1c7y Crystal structure of the holliday junction DNA in complex with a single RuvA tetramer.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		G115 G117 K119 T120 R123
Binding residue
(residue number reindexed from 1)		G115 G117 K119 T120 R123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0009378 four-way junction helicase activity
GO:0042802 identical protein binding
Biological Process
GO:0000725 recombinational repair
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0009314 response to radiation
GO:0009432 SOS response
GO:0032508 DNA duplex unwinding
Cellular Component
GO:0005737 cytoplasm
GO:0009379 Holliday junction helicase complex
GO:0048476 Holliday junction resolvase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1c7y, PDBe:1c7y, PDBj:1c7y
PDBsum1c7y
PubMed10890893
UniProtP0A809|RUVA_ECOLI Holliday junction branch migration complex subunit RuvA (Gene Name=ruvA)

[Back to BioLiP]