Structure of PDB 3j47 Chain U Binding Site BS05

Receptor Information
>3j47 Chain U (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRLTNQLKSLKGLQSKLKDVVEYLDKVIHTILGKLQDVFNLNNLQKALTV
KTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKD
Ligand information
>3j47 Chain T (length=17) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KTNIIEKAMDYAISIEN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j47 Formation of an Intricate Helical Bundle Dictates the Assembly of the 26S Proteasome Lid.
Resolution7.4 Å
Binding residue
(original residue number in PDB)		N280 S284
Binding residue
(residue number reindexed from 1)		N63 S67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3j47, PDBe:3j47, PDBj:3j47
PDBsum3j47
PubMed23911091
UniProtQ08723|RPN8_YEAST 26S proteasome regulatory subunit RPN8 (Gene Name=RPN8)

[Back to BioLiP]