Structure of PDB 7jv5 Chain R Binding Site BS05

Receptor Information
>7jv5 Chain R (length=282) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSD
LLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPNC
DSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAV
HAKNSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCCIDSNTFDVF
VWFGWANSSLNPIIYAFNADFRKAFSTLLGCY
Ligand information
Ligand IDCLR
InChIInChI=1S/C27H46O/c1-18(2)7-6-8-19(3)23-11-12-24-22-10-9-20-17-21(28)13-15-26(20,4)25(22)14-16-27(23,24)5/h9,18-19,21-25,28H,6-8,10-17H2,1-5H3/t19-,21+,22+,23-,24+,25+,26+,27-/m1/s1
InChIKeyHVYWMOMLDIMFJA-DPAQBDIFSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.5.0CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C
CACTVS 3.341CC(C)CCC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC=C4C[C@@H](O)CC[C@]4(C)[C@H]3CC[C@]12C
ACDLabs 10.04OC4CCC3(C(=CCC2C1C(C(C(C)CCCC(C)C)CC1)(C)CCC23)C4)C
OpenEye OEToolkits 1.5.0CC(C)CCC[C@@H](C)[C@H]1CC[C@@H]2[C@@]1(CC[C@H]3[C@H]2CC=C4[C@@]3(CC[C@@H](C4)O)C)C
CACTVS 3.341CC(C)CCC[CH](C)[CH]1CC[CH]2[CH]3CC=C4C[CH](O)CC[C]4(C)[CH]3CC[C]12C
FormulaC27 H46 O
NameCHOLESTEROL
ChEMBLCHEMBL112570
DrugBankDB04540
ZINCZINC000003875383
PDB chain7jv5 Chain R Residue 507 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jv5 Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
I142 V146
Binding residue
(residue number reindexed from 1)
I122 V126
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001588 dopamine neurotransmitter receptor activity, coupled via Gs
GO:0001965 G-protein alpha-subunit binding
GO:0004930 G protein-coupled receptor activity
GO:0004952 dopamine neurotransmitter receptor activity
GO:0005515 protein binding
GO:0032795 heterotrimeric G-protein binding
GO:0035240 dopamine binding
GO:1990763 arrestin family protein binding
Biological Process
GO:0001659 temperature homeostasis
GO:0001661 conditioned taste aversion
GO:0001662 behavioral fear response
GO:0001764 neuron migration
GO:0001963 synaptic transmission, dopaminergic
GO:0001975 response to amphetamine
GO:0006606 protein import into nucleus
GO:0006936 muscle contraction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007212 G protein-coupled dopamine receptor signaling pathway
GO:0007416 synapse assembly
GO:0007612 learning
GO:0007613 memory
GO:0007617 mating behavior
GO:0007625 grooming behavior
GO:0007626 locomotory behavior
GO:0007628 adult walking behavior
GO:0007631 feeding behavior
GO:0008306 associative learning
GO:0008542 visual learning
GO:0009410 response to xenobiotic stimulus
GO:0014002 astrocyte development
GO:0015872 dopamine transport
GO:0016477 cell migration
GO:0019226 transmission of nerve impulse
GO:0019228 neuronal action potential
GO:0021542 dentate gyrus development
GO:0021756 striatum development
GO:0021766 hippocampus development
GO:0021853 cerebral cortex GABAergic interneuron migration
GO:0030335 positive regulation of cell migration
GO:0030432 peristalsis
GO:0035106 operant conditioning
GO:0035249 synaptic transmission, glutamatergic
GO:0042053 regulation of dopamine metabolic process
GO:0042220 response to cocaine
GO:0042311 vasodilation
GO:0042417 dopamine metabolic process
GO:0042711 maternal behavior
GO:0043268 positive regulation of potassium ion transport
GO:0043410 positive regulation of MAPK cascade
GO:0046323 D-glucose import
GO:0046959 habituation
GO:0046960 sensitization
GO:0048148 behavioral response to cocaine
GO:0051281 positive regulation of release of sequestered calcium ion into cytosol
GO:0051584 regulation of dopamine uptake involved in synaptic transmission
GO:0051968 positive regulation of synaptic transmission, glutamatergic
GO:0060134 prepulse inhibition
GO:0060158 phospholipase C-activating dopamine receptor signaling pathway
GO:0060291 long-term synaptic potentiation
GO:0060292 long-term synaptic depression
GO:0071870 cellular response to catecholamine stimulus
GO:0071880 adenylate cyclase-activating adrenergic receptor signaling pathway
GO:0099010 modification of postsynaptic structure
GO:0099171 presynaptic modulation of chemical synaptic transmission
GO:2001224 positive regulation of neuron migration
Cellular Component
GO:0005634 nucleus
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0030425 dendrite
GO:0042734 presynaptic membrane
GO:0042995 cell projection
GO:0043197 dendritic spine
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0060170 ciliary membrane
GO:0097648 G protein-coupled receptor complex
GO:0097730 non-motile cilium
GO:0098978 glutamatergic synapse
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7jv5, PDBe:7jv5, PDBj:7jv5
PDBsum7jv5
PubMed33571431
UniProtP21728|DRD1_HUMAN D(1A) dopamine receptor (Gene Name=DRD1)

[Back to BioLiP]