Structure of PDB 7svw Chain D Binding Site BS05

Receptor Information
>7svw Chain D (length=446) Species: 1469607 ([Scytonema hofmanni] UTEX 2349) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEKNVIATQLSEEAQVKLEVIQSLLEPCDRTTYGQKLREAAEKLNVSLRT
VQRLVKNWEQDGLVGLTQTSRADKGKHRIGEFWENFITKTYKEGNKGSKR
MTPKQVALRVEAKARELKDSKPPNYKTVLRVLAPILEKQQKAKSIRSPGW
RGTTLSVKTREGKDLSVDYSNHVWQCDHTRVDVLLVDQHGEILSRPWLTT
VIDTYSRCIMGINLGFDAPSSGVVALALRHAILPKRYGSEYKLHCEWGTY
GKPEHFYTDGGKDFRSNHLSQIGAQLGFVCHLRDRPSEGGVVERPFKTLN
DQLFSTLPGYTGSNVQERPEDAEKDARLTLRELEQLLVRYIVDRYNQSID
ARMGDQTRFERWEAGLPTVPVPIPERDLDICLMKQSRRTVQRGGCLQFQN
LMYRGEYLAGYAGETVNLRFDPRDITTILVYRQENNQEVFLTRAHA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7svw Mechanistic details of CRISPR-associated transposon recruitment and integration revealed by cryo-EM.
Resolution3.69 Å
Binding residue
(original residue number in PDB)
S175 G177 W178 G318 V319 R322 A379 R380
Binding residue
(residue number reindexed from 1)
S147 G149 W150 G290 V291 R294 A351 R352
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Feb 22 11:35:36 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7svw', asym_id = 'D', bs = 'BS05', title = 'Mechanistic details of CRISPR-associated transposon recruitment and integration revealed by cryo-EM.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7svw', asym_id='D', bs='BS05', title='Mechanistic details of CRISPR-associated transposon recruitment and integration revealed by cryo-EM.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0015074', uniprot = '', pdbid = '7svw', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0015074', uniprot='', pdbid='7svw', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>