Structure of PDB 6h3m Chain D Binding Site BS05

Receptor Information
>6h3m Chain D (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>6h3m Chain Q (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NQHLCGSHLVEALYLVCGERGFFYTPKT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h3m Substitution of an Internal Disulfide Bridge with a Diselenide Enhances both Foldability and Stability of Human Insulin.
Resolution1.821 Å
Binding residue
(original residue number in PDB)
Y16 G20 E21
Binding residue
(residue number reindexed from 1)
Y16 G20 E21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6h3m, PDBe:6h3m, PDBj:6h3m
PDBsum6h3m
PubMed31012517
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]