Structure of PDB 6s48 Chain B Binding Site BS05

Receptor Information

>6s48 Chain B (length=228) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KFIQNAAEIAKKAMDSVDPSLSEKFTIVIRFLTDNPDAASALKGKERSIV
GTEEYIIASATNFKKGRDPRTPLPPSTIPDEMVSVILNKYFEVPSEELEK
AEEWHRLSMGAENIVGDLLERYIAEVIEPHGWIWCSGSMVRAVDFIYCDS
ENVWQSLQVKNRDNTENSSSAAIRHGTPIKKWFRTFSKKRGDNWDKFPSL
EGKENLSEKGFKLYVEKYLSALRAIKAL

Ligand information

>6s48 Chain I (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaccatc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6s48 Restriction endonucleases that cleave RNA/DNA heteroduplexes bind dsDNA in A-like conformation.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	K68 P78 T80 M112 N170
Binding residue (residue number reindexed from 1)	K65 P75 T77 M109 N167

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6s48, PDBe:6s48, PDBj:6s48
PDBsum	6s48
PubMed	32459314
UniProt	Q8YYB7

[Back to BioLiP]