Structure of PDB 6h1c Chain A Binding Site BS05

Receptor Information

>6h1c Chain A (length=132) Species: 208964 (Pseudomonas aeruginosa PAO1)

MVENSELRKAGLKVTLPRVKILQMLDSAEQRHMSAEDVYKALMEAGEDVG
LATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGAHDHMVCVDTGEVIE
FMDAEIEKRQKEIVRERGFELVDANLVLYVRK

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 6h1c Chain A Residue 210

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6h1c Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
• Resolution: 2.34 Å
• Binding residue (original residue number in PDB): H87 D123 N125
• Binding residue (residue number reindexed from 1): H87 D123 N125
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0008198 ferrous iron binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0019290 siderophore biosynthetic process
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900705 negative regulation of siderophore biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:6h1c, PDBe:6h1c, PDBj:6h1c
• PDBsum: 6h1c
• UniProt: Q03456|FUR_PSEAE Ferric uptake regulation protein (Gene Name=fur)