Structure of PDB 5akn Chain A Binding Site BS05

Receptor Information

>5akn Chain A (length=178) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITAKSENLIKQHIAPL
MQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMRE
QIAFIKGLYVAEGDMTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDD
HRHGVYVLNISLRDRIKFVHTILSSHLN

Ligand information

>5akn Chain H (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gttccggcgcgcgcgccggaacttac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5akn Engineering a Nickase on the Homing Endonuclease I-Dmoi Scaffold.
Resolution	2.75 Å
Binding residue (original residue number in PDB)	R104 H175 H181
Binding residue (residue number reindexed from 1)	R99 H170 H176

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing
GO:0016539	intein-mediated protein splicing

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5akn, PDBe:5akn, PDBj:5akn
PDBsum	5akn
PubMed	26045557
UniProt	P21505\|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]