Structure of PDB 4z9v Chain A Binding Site BS05

Receptor Information
>4z9v Chain A (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESV
DKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRK
GQE
Ligand information
>4z9v Chain H (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DEMFSDIYKIREIADGLCLEV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z9v TCTP contains a BH3-like domain, which instead of inhibiting, activates Bcl-xL.
Resolution2.099 Å
Binding residue
(original residue number in PDB)		Q3 E7 V10 S14 Y22 S23 W24 S25 Q26 M83 A84 K87 Q183 W188
Binding residue
(residue number reindexed from 1)		Q4 E8 V11 S15 Y23 S24 W25 S26 Q27 M28 A29 K32 Q128 W133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4z9v, PDBe:4z9v, PDBj:4z9v
PDBsum4z9v
PubMed26813996
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]