Structure of PDB 4d6n Chain A Binding Site BS05

Receptor Information

>4d6n Chain A (length=183) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHLNPLPP

Ligand information

>4d6n Chain H (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gttccggcgcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4d6n Visualizing Phosphodiester-Bond Hydrolysis by an Endonuclease.
Resolution	2.35 Å
Binding residue (original residue number in PDB)	K86 Y89 N93
Binding residue (residue number reindexed from 1)	K82 Y85 N89

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing
GO:0016539	intein-mediated protein splicing

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4d6n, PDBe:4d6n, PDBj:4d6n
PDBsum	4d6n
PubMed	25486305
UniProt	P21505\|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]