Structure of PDB 6enu Chain w Binding Site BS04

Receptor Information
>6enu Chain w (length=188) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGT
RVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAI
GDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTG
GKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK
Ligand information
>6enu Chain x (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggugauuggcgcagccugguagcgcacuucguucgggacgaaggggucg
gagguucgaauccucuaucaccgacca
<<<<<<<..<<<<.........>>>>.<<<<<<.....>>>>>>.....<
<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6enu Structural Basis for Polyproline-Mediated Ribosome Stalling and Rescue by the Translation Elongation Factor EF-P.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		V30 K31 X34 F130 F167 Y183
Binding residue
(residue number reindexed from 1)		V30 K31 X34 F130 F167 Y183
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003746 translation elongation factor activity
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006414 translational elongation
GO:0043043 peptide biosynthetic process
GO:0072344 rescue of stalled ribosome
GO:2001125 negative regulation of translational frameshifting
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6enu, PDBe:6enu, PDBj:6enu
PDBsum6enu
PubMed29100052
UniProtP0A6N4|EFP_ECOLI Elongation factor P (Gene Name=efp)

[Back to BioLiP]