Structure of PDB 6xa1 Chain j Binding Site BS04

Receptor Information
>6xa1 Chain j (length=373) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTAS
NIGSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKV
NIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGT
LQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAV
QLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGG
ENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLK
ALEMGAVEILIVYENLDIMRYLTPPLLEWFANNYKKFGATLEIVTDKSQE
GSQFVKGFGGIGGILRYRVDFQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xa1 Selective inhibition of human translation termination by a drug-like compound.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
T32 T58 N61 I62 X63 N67 C127
Binding residue
(residue number reindexed from 1)
T22 T48 N51 I52 X53 N57 C117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003747 translation release factor activity
GO:0004045 aminoacyl-tRNA hydrolase activity
GO:0005515 protein binding
GO:0008079 translation termination factor activity
GO:0016149 translation release factor activity, codon specific
GO:0043022 ribosome binding
GO:1990825 sequence-specific mRNA binding
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0002184 cytoplasmic translational termination
GO:0006412 translation
GO:0006415 translational termination
GO:0006449 regulation of translational termination
GO:0006479 protein methylation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0018444 translation release factor complex
GO:0022626 cytosolic ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6xa1, PDBe:6xa1, PDBj:6xa1
PDBsum6xa1
PubMed33009412
UniProtP62495|ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1 (Gene Name=ETF1)

[Back to BioLiP]