Structure of PDB 5t2a Chain d Binding Site BS04

Receptor Information
>5t2a Chain d (length=399) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHCKFEHPRHGHLGFLPRKRSRQIRGRARAFPKDDATQKPHLTSFMVFKA
GMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVIVGIVGYRQTPVGLKT
IGTVWAHHTSVEFRRRYYKNWKQSAQLAFSRQKQFANTKEGKVAEARTLN
AFAKKASVIRVIAHTQLRKLRNHRVGVKKAHVQEIQVNGGSVAAKIALAK
SLLEKEVRVDSVFQQSEACDVCSVTKGHGTEGVVKRWGVACLPRKTHRGL
RKVACIGAWHPARVMYTVARAGQHGYHHRTQLNKKIYQIGRSVAVEPNQA
TTTYDLTAKTITPMGGFVGYGTVRNDYVMLKGSVSGPRRRVMTLRRPMAP
QTSRQLKEKIVLKFIDTSSKIGHGRFQTKKEKNQWFGPLKKDRIRREER
Ligand information
>5t2a Chain H (length=93) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucccucuccaaacgagagaacaugcaugggcuggcaugagcggcgaggg
gcagucccgaggcgcugaaccuugaggccucaugcucagggac
<<<<<<<<<.......>>>>....<<<<<<<<.<<.....<<<....<<<
<<.>>>>>....>>>....>>.....>>>.>>>>>...>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R21 Y119 K120 N121 K123 Q124 S125 A126 H174 R175 V176 G177 V178 K179 K180 K227 G228 G230 T231 G316 G320 G322 R340 R341 S370 I372 K380 K383 W386 F387 L390 K391 K392
Binding residue
(residue number reindexed from 1)		R20 Y118 K119 N120 K122 Q123 S124 A125 H173 R174 V175 G176 V177 K178 K179 K226 G227 G229 T230 G315 G319 G321 R339 R340 S369 I371 K379 K382 W385 F386 L389 K390 K391
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Feb 26 18:15:23 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5t2a', asym_id = 'd', bs = 'BS04', title = 'Structures and stabilization of kinetoplastid-sp...led by comparing leishmanial and human ribosomes.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5t2a', asym_id='d', bs='BS04', title='Structures and stabilization of kinetoplastid-sp...led by comparing leishmanial and human ribosomes.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '5t2a', asym_id = 'd'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='5t2a', asym_id='d')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>