Structure of PDB 7qol Chain a Binding Site BS04

Receptor Information
>7qol Chain a (length=107) Species: 2301731 (Bacteroides phage crAss001) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKMLEISEEAITRYFTTLSQFGYKKYSDVDKIIVLFFMEEMLAGEMSYY
VTQDDYRNIVNALYCLAGSTCMIDFPMFESYDTLVHSNNRTFVPRITEDS
ILRSTED
Ligand information
>7qol Chain d (length=25) Species: 2301731 (Bacteroides phage crAss001) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MFFTQEDYRKIEKWLLANSRKDTDF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qol Structural atlas of a human gut crassvirus.
Resolution3.33 Å
Binding residue
(original residue number in PDB)		S48 Y49
Binding residue
(residue number reindexed from 1)		S48 Y49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:7qol, PDBe:7qol, PDBj:7qol
PDBsum7qol
PubMed37138077
UniProtA0A385DVM6|THB_BPCA1 Tail hub protein B (Gene Name=crAss001_39)

[Back to BioLiP]