Structure of PDB 2wqj Chain Z Binding Site BS04

Receptor Information
>2wqj Chain Z (length=31) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTYYLQVRGRENFEILMKLKESLELMELVPQ
Ligand information
>2wqj Chain 1 (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TYYLQVRGRENFEILMKLKESLELME
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wqj Structural Evolution of P53, P63, and P73: Implication for Heterotetramer Formation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
K370 S374 M378 V381 Q383
Binding residue
(residue number reindexed from 1)
K18 S22 M26 V29 Q31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0051262 protein tetramerization
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2wqj, PDBe:2wqj, PDBj:2wqj
PDBsum2wqj
PubMed19815500
UniProtO15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]