Structure of PDB 3j47 Chain U Binding Site BS04

Receptor Information
>3j47 Chain U (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRLTNQLKSLKGLQSKLKDVVEYLDKVIHTILGKLQDVFNLNNLQKALTV
KTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKD
Ligand information
>3j47 Chain S (length=24) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EDPQQVFDERIKFANQLHDEYLVS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j47 Formation of an Intricate Helical Bundle Dictates the Assembly of the 26S Proteasome Lid.
Resolution7.4 Å
Binding residue
(original residue number in PDB)		N270 M274 I276 Y277 I278 N280 L281 S284 F288 L291 I292 N294 K295
Binding residue
(residue number reindexed from 1)		N53 M57 I59 Y60 I61 N63 L64 S67 F71 L74 I75 N77 K78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3j47, PDBe:3j47, PDBj:3j47
PDBsum3j47
PubMed23911091
UniProtQ08723|RPN8_YEAST 26S proteasome regulatory subunit RPN8 (Gene Name=RPN8)

[Back to BioLiP]