Structure of PDB 5j3c Chain QY Binding Site BS04

Receptor Information
>5j3c Chain QY (length=259) Species: 331111 (Escherichia coli O139:H28 str. E24377A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRV
EIMSASEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRI
HTSACTVAVMPELPDAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRI
THLPTGIVVECQDERSQHKNKAKALSVLGARIHAAEMAKRQQAEASTRRN
LLGSGDRSDRNRTYNFPQGRVTDHRINLTLYRLDEVMEGKLDMLIEPIIQ
EHQADQLAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5j3c Uniformity of Peptide Release Is Maintained by Methylation of Release Factors.
Resolution3.04 Å
Binding residue
(original residue number in PDB)		G120 E123 Q185 P188 T190 Q193 R195 I196 H197 T198
Binding residue
(residue number reindexed from 1)		G24 E27 Q89 P92 T94 Q97 R99 I100 H101 T102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003747 translation release factor activity
GO:0005515 protein binding
GO:0016149 translation release factor activity, codon specific
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006415 translational termination
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j3c, PDBe:5j3c, PDBj:5j3c
PDBsum5j3c
PubMed27681416
UniProtP0A7I0|RF1_ECOLI Peptide chain release factor RF1 (Gene Name=prfA)

[Back to BioLiP]