Structure of PDB 5lyb Chain O3 Binding Site BS04

Receptor Information

>5lyb Chain O3 (length=106) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAY
VYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIF
LYPSNI

Ligand information

InChI=1S/6H2N.Os/h6*1H2;/q6*-1;+6

OWCQTVJQFLTQTE-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 12.01 CACTVS 3.370 OpenEye OEToolkits 1.7.0	N[Os](N)(N)(N)(N)N

Formula

H12 N6 Os

Name

osmium (III) hexammine;
osmium(6+) hexaazanide

PDB chain

5lyb Chain O3 Residue 204 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5lyb ?
Resolution	3.25 Å
Binding residue (original residue number in PDB)	F85 R86
Binding residue (residue number reindexed from 1)	F84 R85
Annotation score	1

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lyb, PDBe:5lyb, PDBj:5lyb
PDBsum	5lyb
PubMed	27827794
UniProt	P05744\|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)

[Back to BioLiP]