Structure of PDB 9fmd Chain N Binding Site BS04

Receptor Information

>9fmd Chain N (length=144) Species: 9606 (Homo sapiens)

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF
RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL
CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 9fmd Chain N Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 9fmd Mechanism for the initiation of spliceosome disassembly.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): C101 C105 C137
• Binding residue (residue number reindexed from 1): C101 C105 C137
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016922 nuclear receptor binding
• GO:0030374 nuclear receptor coactivator activity

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045893 positive regulation of DNA-templated transcription
• GO:2000825 positive regulation of androgen receptor activity

Cellular Component

• GO:0000785 chromatin
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:9fmd, PDBe:9fmd, PDBj:9fmd
• PDBsum: 9fmd
• PubMed: 38925148
• UniProt: P41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)