Structure of PDB 5dat Chain M9 Binding Site BS04

Receptor Information

>5dat Chain M9 (length=188) Species: 559292 (Saccharomyces cerevisiae S288C)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA

Ligand information

• Ligand ID: OHX
• InChI: InChI=1S/6H2N.Os/h6*1H2;/q6*-1;+6
• InChIKey: OWCQTVJQFLTQTE-UHFFFAOYSA-N
• SMILES:
  ACDLabs 12.01
  CACTVS 3.370
  OpenEye OEToolkits 1.7.0: N[Os](N)(N)(N)(N)N
• Formula: H12 N6 Os
• Name: osmium (III) hexammine;
  osmium(6+) hexaazanide
• PDB chain: 5dat Chain M9 Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5dat Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
• Resolution: 3.15 Å
• Binding residue (original residue number in PDB): N27 E28
• Binding residue (residue number reindexed from 1): N26 E27
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5dat, PDBe:5dat, PDBj:5dat
• PDBsum: 5dat
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)