Structure of PDB 6zj3 Chain Lf Binding Site BS04

Receptor Information
>6zj3 Chain Lf (length=170) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGLKLQGRLAAALLKCGRNRVWLDPNETSDIAMANSRANVRKLIKDGFII
RKPVAVQSRARWRKLRAAKLKGRHTGPGKRRGTANARMPTKVLWIQRQRV
LRRMLMRYRDAKKIDKHLYRELYMKCKGNVFKNKRLLMEHIHKAKAAKQK
EKLIKDQLDAKKQKSLAKRE
Ligand information
>6zj3 Chain LG (length=207) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcaggaauggcaaacaggcaagugcgagcaagauucuacugucaugggc
uggucgguggcgacacccccuccaggcaucgaaccagugaauccccugug
gaguucucguuuccuccugaugcagacucacgcgggcuaucgaucggcau
gacagauggugguguaugcccuucgcucagcaaggcgguguggucucaca
ccgaugg
.....................<<<<............>>>>.........
.....<<<<....>>>>...........................<<.<.<
<<<.......>>>>.><...<<.<<........<<<<<<<.......<<<
.....>>>.....>>>.>>>>....>>>>....>.<<<<<<<....>>>>
>>>..>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		R10 K17 S38 R39 A40 R43 K44 R53 S60 R61 W64 R65 K93 W96 I97 R101 R104 R111 H119 Y121 R122 E123 Y125 M126 K129 K150
Binding residue
(residue number reindexed from 1)		R8 K15 S36 R37 A38 R41 K42 R51 S58 R59 W62 R63 K91 W94 I95 R99 R102 R109 H117 Y119 R120 E121 Y123 M124 K127 K148
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 04:47:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'Lf', bs = 'BS04', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='Lf', bs='BS04', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0022625', uniprot = '', pdbid = '6zj3', asym_id = 'Lf'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0022625', uniprot='', pdbid='6zj3', asym_id='Lf')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>