Structure of PDB 8rxh Chain Le Binding Site BS04

Receptor Information
>8rxh Chain Le (length=186) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRAGMKGKVLGKEKKAAIIDARKKAAESRKNRDDKRWKRVLANMDEEKRK
KFHGVGNTAKNSRVRGATRASLLKRTGRKPDAVSMEATIHLSKLLKKKTF
SKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLI
QRKSETTEGNKHKHFYTVISNVPVASFKGLTTKTVE
Ligand information
>8rxh Chain L5 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuacgucccucuccaaacgagagaacaugcaugggcuggcaugagcggca
ugcuucuccgguggggcuccgucccgaggcgcugaaccuugaggccugaa
aauucaugcucagggacacu
....<<<<<<<<<.......>>>>....<<<<<<<<.<<.....<<<...
..............<<.......>>....>>>....>>.....>>>....
....>>>>>...>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		T2 R3 A4 K7 K9 K13 K16 H54 N62 R64 R66 T69 R70 R76 G78 K80 T89 H91 S93 K94 K97 F115 R146 K179 G180 L181
Binding residue
(residue number reindexed from 1)		T1 R2 A3 K6 K8 K12 K15 H53 N61 R63 R65 T68 R69 R75 G77 K79 T88 H90 S92 K93 K96 F114 R145 K178 G179 L180
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum8rxh
PubMed38722744
UniProtE9AFF2

[Back to BioLiP]