Structure of PDB 8rxx Chain LH Binding Site BS04

Receptor Information
>8rxx Chain LH (length=221) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFPSRKDAFRAQRKGAKKHRPEIIVIDLKDHVLGRAAAVVAKQLLLGKKI
TVVRCEQLNIAGTEIRNKIKYLQYLRKRKLTNPTKGPFHHRAPSDVFVRT
VRSMLPRYTKRGMKALNSLVAYEGIPPNVVRTGGRVVIPRAQRHVCYRSE
RPYTVLGNMCKHVGWKYSDVVANLEKARVEKASRHHEKQAKLRDAWKSAR
KEALAKMPKHNVEVLKKFGYA
Ligand information
>8rxx Chain L6 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgccaag
uauauucaugaucacaagaca
......<.<<<............<<<<<..>>>>>......>>>......
..................>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		R11 R14 K15 K30 R55 V131 R132 G134 G135 R136 R179 A183 H187 W197 R201 H211 N212 G220 Y221
Binding residue
(residue number reindexed from 1)		R10 R13 K14 K29 R54 V130 R131 G133 G134 R135 R178 A182 H186 W196 R200 H210 N211 G219 Y220
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum8rxx
PubMed38722744
UniProtQ4QFG2

[Back to BioLiP]