Structure of PDB 8rxh Chain LE Binding Site BS04

Receptor Information
>8rxh Chain LE (length=186) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKN
RTFTVIRWFGSKIPIACLNTTKAHVQNMITGVTKGYRFKVRCAYAHFPIN
VSVDGQNIEVRNFLGEKRVRRQLVPNTVKVSQTDPSKVKDEIVFDGNDLE
QVSREAAVLHQMCLVKKKDIRKFLDGIYVQTKTNIE
Ligand information
>8rxh Chain L6 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgccaag
uauauucaugaucacaagaca
......<.<<<............<<<<<..>>>>>......>>>......
..................>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		K5 R23 Q42 L43 D44 R46 D48 K50 R58 W59
Binding residue
(residue number reindexed from 1)		K4 R22 Q41 L42 D43 R45 D47 K49 R57 W58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum8rxh
PubMed38722744
UniProtQ4QC91

[Back to BioLiP]