Structure of PDB 2y9h Chain K Binding Site BS04

Receptor Information
>2y9h Chain K (length=191) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLE
PAEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRAN
PAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEPWVQILQDTFLEQ
VQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y9h An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		W145 Q147 L149 R179
Binding residue
(residue number reindexed from 1)		W139 Q141 L143 R159
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2y9h, PDBe:2y9h, PDBj:2y9h
PDBsum2y9h
PubMed21572442
UniProtQ53WG9|CAS6_THET8 CRISPR-associated endoribonuclease Cse3 (Gene Name=cse3)

[Back to BioLiP]