Structure of PDB 5j4d Chain JA Binding Site BS04

Receptor Information

>5j4d Chain JA (length=258) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMS
ASEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSA
CTVAVMPELPDAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLP
TGIVVECQDERSQHKNKAKALSVLGARIHAAEMAKRQQAEASTRRNLLGS
GDRSDRNRTYNFPQGRVTDHRINLTLYRLDEVMEGKLDMLIEPIIQEHQA
DQLAALSE

Ligand information

>5j4d Chain IA (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca

.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5j4d Structural Basis for Translation Termination on a Pseudouridylated Stop Codon.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	E155 G233 G234 Q235 E260 R261 K265
Binding residue (residue number reindexed from 1)	E55 G133 G134 Q135 E160 R161 K165

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003747	translation release factor activity
GO:0005515	protein binding
GO:0016149	translation release factor activity, codon specific
GO:0043022	ribosome binding

	Biological Process
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5j4d, PDBe:5j4d, PDBj:5j4d
PDBsum	5j4d
PubMed	27107638
UniProt	P0A7I0\|RF1_ECOLI Peptide chain release factor RF1 (Gene Name=prfA)

[Back to BioLiP]