Structure of PDB 6tc2 Chain J Binding Site BS04

Receptor Information
>6tc2 Chain J (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>6tc2 Chain L (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tc2 Insulin polymorphism induced by two polyphenols: new crystal forms and advances in macromolecular powder diffraction.
Resolution1.36 Å
Binding residue
(original residue number in PDB)
G8 S9 V12 E13 Y16 G23 F24 F25 Y26 P28
Binding residue
(residue number reindexed from 1)
G8 S9 V12 E13 Y16 G23 F24 F25 Y26 P28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6tc2, PDBe:6tc2, PDBj:6tc2
PDBsum6tc2
PubMed33135678
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]