--> -->

Structure of PDB 7qrm Chain I Binding Site BS04

Receptor Information
>7qrm Chain I (length=214) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATG
FAMTFYYRPTVTDAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHV
FRVYLTGGFKKPRELTWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIV
TGVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLM
HFLMIRKQGISGPL
 
 
IndexError
Python 3.6.8: /usr/bin/python3
Fri Nov 15 23:21:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7qrm', asym_id = 'I', bs = 'BS04', title = 'High-resolution cryo-EM structures of plant cytochrome b 6 f at work.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7qrm', asym_id='I', bs='BS04', title='High-resolution cryo-EM structures of plant cytochrome b 6 f at work.')
    925                 p=subprocess.Popen(cmd,shell=True,stdout=subprocess.PIPE)
    926                 stdout,stderr=p.communicate()
=>  927                 line     =stdout.decode().splitlines()[0]
    928                 items    =line.split('\t')
    929                 rhea     ='\n'.join(["RHEA:"+r for r in items[2].split(',')])
line = '7qrm\tI\tHEC\t1', stdout = b'', stdout.decode = <built-in method decode of bytes object>, ).splitlines undefined

IndexError: list index out of range
      args = ('list index out of range',)
      with_traceback = <built-in method with_traceback of IndexError object>