Structure of PDB 7pkt Chain I Binding Site BS04

Receptor Information
>7pkt Chain I (length=97) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VFKTTGGRSWNPPSGLRPLSPAQRRNRTKNLALTMKNMSILKLAEANQPE
VPVRLYKPLNFSRMQWMKKKLEETRAALGWDMEARALQEQARALRVG
Ligand information
>7pkt Chain 5 (length=149) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aagguagagucugcguugaacaccagaacauaggcuuggaagcagccacu
gugcuuggaaagcguaauagcucacuggucuagcagucuccgcuuauaua
uguccggcacuauugccgaagcccgccuaugacaaauuuuuuuuuuuuu
<<..<.<<<.<<<........<<<<<.<<...<<<<.......>>>>...
>>........<<<......>>>..>>>>>....>>>.>>>.>.>>.....
.................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
R34 T37 K38 A41 K45 K77
Binding residue
(residue number reindexed from 1)
R25 T28 K29 A32 K36 K68
Enzymatic activity
Enzyme Commision number ?
External links