Structure of PDB 6az3 Chain H Binding Site BS04

Receptor Information
>6az3 Chain H (length=221) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFPSRKDASRAQRKSAKKHRPEIIVIDLKDHVLGRAAAVVAKQLLLGKKI
TVVRCEQLNIAGTEIRNKIKYLQYLRKRKLTNPTKGPFHHRAPSDVFVRT
VRSMLPRYTKRGMKALNSLVAYEGIPPNVVRTGGRVVIPRAQRHVCYRSE
RPYTVLGNMCKHVGWKYSDVVANLEKARVEKASRHHEKQAKLREAWKAAR
KEALAKMPKHNVEVLKKFGYA
Ligand information
>6az3 Chain 6 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgccaag
uauauucaugaucacaagaca
......<.<<<............<<<<....>>>>......>>>......
..................>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R11 R14 K30 V131 G134 R136 H145 R179 V180 A183 H187 W197 R201 H211 N212 G220 Y221
Binding residue
(residue number reindexed from 1)		R10 R13 K29 V130 G133 R135 H144 R178 V179 A182 H186 W196 R200 H210 N211 G219 Y220
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 16:54:53 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6az3', asym_id = 'H', bs = 'BS04', title = 'Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6az3', asym_id='H', bs='BS04', title='Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '6az3', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='6az3', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>