Structure of PDB 3jcs Chain H Binding Site BS04

Receptor Information
>3jcs Chain H (length=202) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPEIIVIDLKDHVLGRAAAVVAKQLLLGKKITVVRCEQLNIAGTEIRNKI
KYLQYLRKRKLTNPTKGPFHHRAPSDVFVRTVRSMLPRYTKRGMKALNSL
VAYEGIPPNVVRTGGRVVIPRAQRHVCYRSERPYTVLGNMCKHVGWKYSD
VVANLEKARVEKASRHHEKQAKLREAWKAARKEALAKMPKHNVEVLKKFG
YA
Ligand information
>3jcs Chain 6 (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucaucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgcca
aguauauucau
.......<..........................>...............
...........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G134 G135 V180 S184 H187 E188 Q190 R194 W197 K198 R201 P209 H211 Y221
Binding residue
(residue number reindexed from 1)		G114 G115 V160 S164 H167 E168 Q170 R174 W177 K178 R181 P189 H191 Y201
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 14:23:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3jcs', asym_id = 'H', bs = 'BS04', title = '2.8- angstrom Cryo-EM Structure of the Large Rib... Subunit from the Eukaryotic Parasite Leishmania.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3jcs', asym_id='H', bs='BS04', title='2.8- angstrom Cryo-EM Structure of the Large Rib... Subunit from the Eukaryotic Parasite Leishmania.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '3jcs', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='3jcs', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>