Structure of PDB 7vo0 Chain G Binding Site BS04

Receptor Information

>7vo0 Chain G (length=131) Species: 100226 (Streptomyces coelicolor A3(2))

PPVKGRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTL
QSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVE
KWAEAIAAEHGYVNVAHTVEIFGTCADCAGA

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7vo0 Chain G Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7vo0 Structural basis of Streptomyces transcription activation by zinc uptake regulator.
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): D65 C79 H85 H87
• Binding residue (residue number reindexed from 1): D60 C74 H80 H82
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900376 regulation of secondary metabolite biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:7vo0, PDBe:7vo0, PDBj:7vo0
• PDBsum: 7vo0
• PubMed: 35871291
• UniProt: Q9L2H5