Structure of PDB 5x07 Chain F Binding Site BS04

Receptor Information
>5x07 Chain F (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQ
NSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5x07 Structure of the Forkhead Domain of FOXA2 Bound to a Complete DNA Consensus Site
Resolution2.796 Å
Binding residue
(original residue number in PDB)
G155 P156 Q198
Binding residue
(residue number reindexed from 1)
G1 P2 Q44
Binding affinityPDBbind-CN: Kd=105nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5x07, PDBe:5x07, PDBj:5x07
PDBsum5x07
PubMed28644006
UniProtQ9Y261|FOXA2_HUMAN Hepatocyte nuclear factor 3-beta (Gene Name=FOXA2)

[Back to BioLiP]