Structure of PDB 2as5 Chain F Binding Site BS04

Receptor Information
>2as5 Chain F (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNA
VRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2as5 FOXP3 Controls Regulatory T Cell Function through Cooperation with NFAT.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
V503 R542
Binding residue
(residue number reindexed from 1)
V2 R41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2as5, PDBe:2as5, PDBj:2as5
PDBsum2as5
PubMed16873067
UniProtO15409|FOXP2_HUMAN Forkhead box protein P2 (Gene Name=FOXP2)

[Back to BioLiP]