Structure of PDB 1ev6 Chain F Binding Site BS04

Receptor Information
>1ev6 Chain F (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1ev6 Chain H (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ev6 R6 Hexameric Insulin Complexed with m-Cresol or Resorcinol
Resolution1.9 Å
Binding residue
(original residue number in PDB)		H5 G8 S9 V12 E13 Y16 G23 F24 F25 Y26 P28
Binding residue
(residue number reindexed from 1)		H5 G8 S9 V12 E13 Y16 G23 F24 F25 Y26 P28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ev6, PDBe:1ev6, PDBj:1ev6
PDBsum1ev6
PubMed11092919
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]