Structure of PDB 3vbk Chain E Binding Site BS04

Receptor Information
>3vbk Chain E (length=186) Species: 699184 (Bacillus cereus SJ1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNSFYSQEELKKIGFLSVGKNVLISKKASIYNPGVISIGNNVRIDDFCIL
SGKVTIGSYSHIAAYTALYGGEVGIEMYDFANIASRTIVYAAIDDFSGNA
LMGPTIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMV
KESLDDWYIYVGVPVRKIKARKRKIVELENEFLKSM
Ligand information
Ligand ID0FX
InChIInChI=1S/C16H27N3O14P2/c1-6-4-19(16(24)18-14(6)23)10-3-8(20)9(31-10)5-29-34(25,26)33-35(27,28)32-15-13(22)12(21)11(17)7(2)30-15/h4,7-13,15,20-22H,3,5,17H2,1-2H3,(H,25,26)(H,27,28)(H,18,23,24)/t7-,8+,9-,10-,11-,12+,13-,15-/m1/s1
InChIKeyUIVJXHWSIFBBCY-LPGAPTBISA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.6CC1C(C(C(C(O1)OP(=O)(O)OP(=O)(O)OCC2C(CC(O2)N3C=C(C(=O)NC3=O)C)O)O)O)N
CACTVS 3.370C[CH]1O[CH](O[P](O)(=O)O[P](O)(=O)OC[CH]2O[CH](C[CH]2O)N3C=C(C)C(=O)NC3=O)[CH](O)[CH](O)[CH]1N
OpenEye OEToolkits 1.7.6C[C@@H]1[C@H]([C@@H]([C@H]([C@H](O1)OP(=O)(O)OP(=O)(O)OC[C@@H]2[C@H](C[C@@H](O2)N3C=C(C(=O)NC3=O)C)O)O)O)N
CACTVS 3.370C[C@H]1O[C@H](O[P](O)(=O)O[P](O)(=O)OC[C@H]2O[C@H](C[C@@H]2O)N3C=C(C)C(=O)NC3=O)[C@H](O)[C@@H](O)[C@@H]1N
ACDLabs 12.01O=C1C(=CN(C(=O)N1)C2OC(C(O)C2)COP(=O)(OP(=O)(OC3OC(C(N)C(O)C3O)C)O)O)C
FormulaC16 H27 N3 O14 P2
NamedTDP-4-amino-4,6-dideoxyglucose
ChEMBL
DrugBank
ZINCZINC000030725213
PDB chain3vbk Chain E Residue 1500 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vbk Structural Studies of AntD: An N-Acyltransferase Involved in the Biosynthesis of d-Anthrose.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N2 S3 F4 R43 D45 D46 H61
Binding residue
(residue number reindexed from 1)		N2 S3 F4 R43 D45 D46 H61
Annotation score4
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Feb 16 21:24:22 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3vbk', asym_id = 'E', bs = 'BS04', title = 'Structural Studies of AntD: An N-Acyltransferase Involved in the Biosynthesis of d-Anthrose.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3vbk', asym_id='E', bs='BS04', title='Structural Studies of AntD: An N-Acyltransferase Involved in the Biosynthesis of d-Anthrose.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0016740', uniprot = '', pdbid = '3vbk', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016740', uniprot='', pdbid='3vbk', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>