Structure of PDB 6bz1 Chain D Binding Site BS04

Receptor Information
>6bz1 Chain D (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSS
NKLFQYASTDMDKVLLKYTEYSEPHESRTNTVILETL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bz1 The Cancer Mutation D83V Induces an alpha-Helix to beta-Strand Conformation Switch in MEF2B.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		E14 Q18 S51
Binding residue
(residue number reindexed from 1)		E13 Q17 S50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bz1, PDBe:6bz1, PDBj:6bz1
PDBsum6bz1
PubMed29477338
UniProtQ02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A (Gene Name=MEF2A);
Q02080|MEF2B_HUMAN Myocyte-specific enhancer factor 2B (Gene Name=MEF2B)

[Back to BioLiP]