Structure of PDB 5lj5 Chain D Binding Site BS04

Receptor Information
>5lj5 Chain D (length=114) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRC
LECNEYIPKSRKFNGKKELLKEKYLDSIKIYRLTISCPRCANSIAFRTDP
GNSDYVMEVGGVRN
Ligand information
>5lj5 Chain V (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuu
<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>..................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lj5 Cryo-EM structure of the spliceosome immediately after branching.
Resolution10.0 Å
Binding residue
(original residue number in PDB)		K32 T33 R42 M44 P59 S61 R62 K63 N65
Binding residue
(residue number reindexed from 1)		K31 T32 R41 M43 P58 S60 R61 K62 N64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0005515 protein binding
GO:0030620 U2 snRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000349 generation of catalytic spliceosome for first transesterification step
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lj5, PDBe:5lj5, PDBj:5lj5
PDBsum5lj5
PubMed27459055
UniProtP28320|YJU2_YEAST Splicing factor YJU2 (Gene Name=YJU2)

[Back to BioLiP]