Structure of PDB 5jgh Chain D Binding Site BS04

Receptor Information
>5jgh Chain D (length=155) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KASKRTQLRNELIKQGPKRPTSAYFLYLQDHRSQFVKENPTLRPAEISKI
AGEKWQNLEADIKEKYISERKKLYSEYQKAKKEFDEKLPPKKPAGPFIKY
ANEVRSQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQEY
NARYP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jgh DNA structure directs positioning of the mitochondrial genome packaging protein Abf2p.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
K27 S29 T32 K117 K118 I124 R131 Q143 M147
Binding residue
(residue number reindexed from 1)
K1 S3 T6 K91 K92 I98 R105 Q117 M121
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5jgh, PDBe:5jgh, PDBj:5jgh
PDBsum5jgh
PubMed27899643
UniProtQ02486|ABF2_YEAST ARS-binding factor 2, mitochondrial (Gene Name=ABF2)

[Back to BioLiP]