Structure of PDB 4unc Chain D Binding Site BS04

Receptor Information
>4unc Chain D (length=192) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIA
PLMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNM
REQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHL
DDHRHGVYVLNISLRDRIKFVHTILSSHLNPLPPEAAALEHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4unc Visualizing Phosphodiester-Bond Hydrolysis by an Endonuclease.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
D21 A116 E117 D119 K120 R126 W128
Binding residue
(residue number reindexed from 1)
D18 A113 E114 D116 K117 R123 W125
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4unc, PDBe:4unc, PDBj:4unc
PDBsum4unc
PubMed25486305
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]