Structure of PDB 9c3s Chain C Binding Site BS04

Receptor Information
>9c3s Chain C (length=244) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LHNRDFLTDAAHLPDASIDLIVADPPYGLGKDYGNDSDKRSGDDFLAWTR
EWLELAIPKLKPSGSMYIFCTWQYAPEIFSFLKTQLTMVNEIIWDRRVPS
MGGTTRRFTSVHDNIGFFAVSRAYYFDLDPVRIPYDADTKKARSRKLFEG
SKWLEMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMVLASCPPGG
RVLDPFMGSGTTAVACARQGRDFVGYEINESYCAIAHERVNALA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c3s Burkholderia cenocepacia epigenetic regulator M.BceJIV simultaneously engages two DNA recognition sequences for methylation.
Resolution2.16 Å
Binding residue
(original residue number in PDB)		R167 Y170 R178 F183 K187 W188 Y193 N194 K196
Binding residue
(residue number reindexed from 1)		R132 Y135 R143 F148 K152 W153 Y158 N159 K161
External links